RHOB Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2106251
Artikelname: RHOB Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2106251
Hersteller Artikelnummer: orb2106251
Alternativnummer: BYT-ORB2106251-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHOB
Konjugation: HRP
Alternative Synonym: ARH6, ARHB, RHOH6, MST081, MSTP081
RHOB Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 004031
UniProt: P62745
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY