RHOB Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2106251
Article Name: RHOB Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106251
Supplier Catalog Number: orb2106251
Alternative Catalog Number: BYT-ORB2106251-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHOB
Conjugation: HRP
Alternative Names: ARH6, ARHB, RHOH6, MST081, MSTP081
RHOB Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 004031
UniProt: P62745
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY