RHOB Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2106252
Artikelname: RHOB Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2106252
Hersteller Artikelnummer: orb2106252
Alternativnummer: BYT-ORB2106252-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHOB
Konjugation: FITC
Alternative Synonym: ARH6, ARHB, RHOH6, MST081, MSTP081
RHOB Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 004031
UniProt: P62745
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY