RHOB Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2106252
Article Name: RHOB Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106252
Supplier Catalog Number: orb2106252
Alternative Catalog Number: BYT-ORB2106252-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHOB
Conjugation: FITC
Alternative Names: ARH6, ARHB, RHOH6, MST081, MSTP081
RHOB Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 004031
UniProt: P62745
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY