RPSA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2106289
| Artikelname: |
RPSA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2106289 |
| Hersteller Artikelnummer: |
orb2106289 |
| Alternativnummer: |
BYT-ORB2106289-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human RPSA |
| Konjugation: |
Biotin |
| Alternative Synonym: |
SA, LBP, LRP, p40, 67LR, ICAS, lamR, 37LRP, LAMBR, LAMR1, LRP/LR, LBP/p40, NEM/1CHD4 |
| RPSA Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
33kDa |
| NCBI: |
002286 |
| UniProt: |
P08865 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY |
