RPSA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2106289
| Article Name: |
RPSA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2106289 |
| Supplier Catalog Number: |
orb2106289 |
| Alternative Catalog Number: |
BYT-ORB2106289-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human RPSA |
| Conjugation: |
Biotin |
| Alternative Names: |
SA, LBP, LRP, p40, 67LR, ICAS, lamR, 37LRP, LAMBR, LAMR1, LRP/LR, LBP/p40, NEM/1CHD4 |
| RPSA Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
33kDa |
| NCBI: |
002286 |
| UniProt: |
P08865 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY |
