GLE1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2106443
Artikelname: GLE1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2106443
Hersteller Artikelnummer: orb2106443
Alternativnummer: BYT-ORB2106443-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLE1
Konjugation: HRP
Alternative Synonym: LCCS, CAAHC, CAAHD, GLE1L, LCCS1, hGLE1
GLE1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 75kDa
NCBI: 001490
UniProt: Q53GS7
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ