GLE1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2106443
Article Name: GLE1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106443
Supplier Catalog Number: orb2106443
Alternative Catalog Number: BYT-ORB2106443-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLE1
Conjugation: HRP
Alternative Names: LCCS, CAAHC, CAAHD, GLE1L, LCCS1, hGLE1
GLE1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 001490
UniProt: Q53GS7
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ