MEIOC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2106599
Artikelname: MEIOC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2106599
Hersteller Artikelnummer: orb2106599
Alternativnummer: BYT-ORB2106599-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ35848
Konjugation: HRP
Alternative Synonym: C17orf104
MEIOC Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 71kDa
NCBI: 001028831
UniProt: A2RUB1
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP