MEIOC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2106599
Article Name: MEIOC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106599
Supplier Catalog Number: orb2106599
Alternative Catalog Number: BYT-ORB2106599-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ35848
Conjugation: HRP
Alternative Names: C17orf104
MEIOC Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 001028831
UniProt: A2RUB1
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP