TSPYL6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2106778
Artikelname: TSPYL6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2106778
Hersteller Artikelnummer: orb2106778
Alternativnummer: BYT-ORB2106778-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TSPYL6
Konjugation: Biotin
Alternative Synonym: DKFZp434B125
TSPYL6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 46
NCBI: 001003937
UniProt: Q8N831
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP