TSPYL6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106778
Article Name: TSPYL6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106778
Supplier Catalog Number: orb2106778
Alternative Catalog Number: BYT-ORB2106778-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TSPYL6
Conjugation: Biotin
Alternative Names: DKFZp434B125
TSPYL6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 46
NCBI: 001003937
UniProt: Q8N831
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP