FAM13C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2106784
Artikelname: FAM13C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2106784
Hersteller Artikelnummer: orb2106784
Alternativnummer: BYT-ORB2106784-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM13C1
Konjugation: Biotin
Alternative Synonym: FAM13C1
FAM13C1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 001001971
UniProt: Q8NE31
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RPSMGNFKSRKPKSIFKAESGRSHGESQETEHVVSSQSECQVRAGTPAHE