FAM13C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106784
Article Name: FAM13C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106784
Supplier Catalog Number: orb2106784
Alternative Catalog Number: BYT-ORB2106784-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM13C1
Conjugation: Biotin
Alternative Names: FAM13C1
FAM13C1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 001001971
UniProt: Q8NE31
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RPSMGNFKSRKPKSIFKAESGRSHGESQETEHVVSSQSECQVRAGTPAHE