Spata6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107243
Artikelname: Spata6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107243
Hersteller Artikelnummer: orb2107243
Alternativnummer: BYT-ORB2107243-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Spata6
Konjugation: Biotin
Alternative Synonym: Hash
Spata6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 599219
UniProt: Q99MU5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RVKDVLKSHQAHGRHLCEERDPEKEDELELKRSLLYRDSAYDSDPEYSSF