Spata6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107243
Article Name: Spata6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107243
Supplier Catalog Number: orb2107243
Alternative Catalog Number: BYT-ORB2107243-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Spata6
Conjugation: Biotin
Alternative Names: Hash
Spata6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 599219
UniProt: Q99MU5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RVKDVLKSHQAHGRHLCEERDPEKEDELELKRSLLYRDSAYDSDPEYSSF