C2orf42 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107270
Artikelname: C2orf42 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107270
Hersteller Artikelnummer: orb2107270
Alternativnummer: BYT-ORB2107270-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf42
Konjugation: Biotin
Alternative Synonym: FLJ20558
C2orf42 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 63kDa
NCBI: 060350
UniProt: Q9NWW7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV