C2orf42 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107270
Article Name: C2orf42 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107270
Supplier Catalog Number: orb2107270
Alternative Catalog Number: BYT-ORB2107270-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf42
Conjugation: Biotin
Alternative Names: FLJ20558
C2orf42 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 060350
UniProt: Q9NWW7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV