DHRS9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107705
Artikelname: DHRS9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107705
Hersteller Artikelnummer: orb2107705
Alternativnummer: BYT-ORB2107705-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DHRS9
Konjugation: Biotin
Alternative Synonym: RDHL, RDH15, RDH-E2, RDHTBE, SDR9C4, RDH-TBE, RETSDR8, 3ALPHA-HSD, 3-alpha-HSD
DHRS9 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 954674
UniProt: Q9BPW9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV