DHRS9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107705
Article Name: DHRS9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107705
Supplier Catalog Number: orb2107705
Alternative Catalog Number: BYT-ORB2107705-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DHRS9
Conjugation: Biotin
Alternative Names: RDHL, RDH15, RDH-E2, RDHTBE, SDR9C4, RDH-TBE, RETSDR8, 3ALPHA-HSD, 3-alpha-HSD
DHRS9 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 954674
UniProt: Q9BPW9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV