DEUP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2107811
Artikelname: DEUP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2107811
Hersteller Artikelnummer: orb2107811
Alternativnummer: BYT-ORB2107811-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human CCDC67
Konjugation: HRP
Alternative Synonym: CCDC67
DEUP1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 857596
UniProt: Q05D60
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: HQMKQNKVPRKELPHLKEEIPFELSNLNQKLEEFRAKSREWDKQEILYQT