DEUP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2107811
Article Name: DEUP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107811
Supplier Catalog Number: orb2107811
Alternative Catalog Number: BYT-ORB2107811-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human CCDC67
Conjugation: HRP
Alternative Names: CCDC67
DEUP1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 857596
UniProt: Q05D60
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: HQMKQNKVPRKELPHLKEEIPFELSNLNQKLEEFRAKSREWDKQEILYQT