TRAPPC5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107975
Artikelname: TRAPPC5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107975
Hersteller Artikelnummer: orb2107975
Alternativnummer: BYT-ORB2107975-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRAPPC5
Konjugation: Biotin
Alternative Synonym: TRS31
TRAPPC5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 777554
UniProt: Q8IUR0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MEARFTRGKSALLERALARPRTEVSLSAFALLFSELVQHCQSRVFSVAEL