TRAPPC5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107975
Article Name: TRAPPC5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107975
Supplier Catalog Number: orb2107975
Alternative Catalog Number: BYT-ORB2107975-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRAPPC5
Conjugation: Biotin
Alternative Names: TRS31
TRAPPC5 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 777554
UniProt: Q8IUR0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MEARFTRGKSALLERALARPRTEVSLSAFALLFSELVQHCQSRVFSVAEL