SPINDOC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2109002
Artikelname: SPINDOC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2109002
Hersteller Artikelnummer: orb2109002
Alternativnummer: BYT-ORB2109002-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CK084
Konjugation: HRP
Alternative Synonym: C11orf84, SPIN-DOC
SPINDOC Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 612480
UniProt: Q9BUA3
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LEQHPHTLDLSPSEKSNILEAWSEGVALLQDVRAEQPSPPNSDSGQDAHP