SPINDOC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2109002
Article Name: SPINDOC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109002
Supplier Catalog Number: orb2109002
Alternative Catalog Number: BYT-ORB2109002-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CK084
Conjugation: HRP
Alternative Names: C11orf84, SPIN-DOC
SPINDOC Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 612480
UniProt: Q9BUA3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LEQHPHTLDLSPSEKSNILEAWSEGVALLQDVRAEQPSPPNSDSGQDAHP