Wdr92 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2109017
Artikelname: Wdr92 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2109017
Hersteller Artikelnummer: orb2109017
Alternativnummer: BYT-ORB2109017-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: HRP
Alternative Synonym: HZGJ, AI553587
Wdr92 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 849240
UniProt: Q8BGF3
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: NMEPAQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMSLRW