Wdr92 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Catalog Number:
BYT-ORB2109017
| Article Name: |
Wdr92 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2109017 |
| Supplier Catalog Number: |
orb2109017 |
| Alternative Catalog Number: |
BYT-ORB2109017-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
HRP |
| Alternative Names: |
HZGJ, AI553587 |
| Wdr92 Rabbit Polyclonal Antibody (HRP) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
39kDa |
| NCBI: |
849240 |
| UniProt: |
Q8BGF3 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: NMEPAQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMSLRW |
