GPRASP2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2109038
Artikelname: GPRASP2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2109038
Hersteller Artikelnummer: orb2109038
Alternativnummer: BYT-ORB2109038-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPRASP2
Konjugation: HRP
Alternative Synonym: DFNX7, GASP2
GPRASP2 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 94kDa
NCBI: 612446
UniProt: Q96D09
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ