GPRASP2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2109038
Article Name: GPRASP2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109038
Supplier Catalog Number: orb2109038
Alternative Catalog Number: BYT-ORB2109038-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPRASP2
Conjugation: HRP
Alternative Names: DFNX7, GASP2
GPRASP2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 94kDa
NCBI: 612446
UniProt: Q96D09
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ