RRAGB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109388
Artikelname: RRAGB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109388
Hersteller Artikelnummer: orb2109388
Alternativnummer: BYT-ORB2109388-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRAGB
Konjugation: Biotin
Alternative Synonym: RAGB, bA465E19.1
RRAGB Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 38 kDa
UniProt: Q5VZM2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLM