RRAGB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109388
Article Name: RRAGB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109388
Supplier Catalog Number: orb2109388
Alternative Catalog Number: BYT-ORB2109388-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRAGB
Conjugation: Biotin
Alternative Names: RAGB, bA465E19.1
RRAGB Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 38 kDa
UniProt: Q5VZM2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLM