DNAJB4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109544
Artikelname: DNAJB4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109544
Hersteller Artikelnummer: orb2109544
Alternativnummer: BYT-ORB2109544-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DNAJB4
Konjugation: Biotin
Alternative Synonym: DjB4, HLJ1, DNAJW
DNAJB4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 008965
UniProt: Q9UDY4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EGTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLR