DNAJB4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109544
Article Name: DNAJB4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109544
Supplier Catalog Number: orb2109544
Alternative Catalog Number: BYT-ORB2109544-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DNAJB4
Conjugation: Biotin
Alternative Names: DjB4, HLJ1, DNAJW
DNAJB4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 008965
UniProt: Q9UDY4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EGTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLR