SDCCAG8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109640
Artikelname: SDCCAG8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109640
Hersteller Artikelnummer: orb2109640
Alternativnummer: BYT-ORB2109640-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SDCCAG8
Konjugation: Biotin
Alternative Synonym: BBS16, CCCAP, SLSN7, NPHP10, hCCCAP, HSPC085, NY-CO-8, CCCAP SLSN7
SDCCAG8 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 006633
UniProt: Q86SQ7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLE