SDCCAG8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109640
Article Name: SDCCAG8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109640
Supplier Catalog Number: orb2109640
Alternative Catalog Number: BYT-ORB2109640-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SDCCAG8
Conjugation: Biotin
Alternative Names: BBS16, CCCAP, SLSN7, NPHP10, hCCCAP, HSPC085, NY-CO-8, CCCAP SLSN7
SDCCAG8 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 006633
UniProt: Q86SQ7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLE