MYL6B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109970
Artikelname: MYL6B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109970
Hersteller Artikelnummer: orb2109970
Alternativnummer: BYT-ORB2109970-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MYL6B
Konjugation: Biotin
Alternative Synonym: MLC1SA
MYL6B Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 002466
UniProt: P14649
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFL