MYL6B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109970
Article Name: MYL6B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109970
Supplier Catalog Number: orb2109970
Alternative Catalog Number: BYT-ORB2109970-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MYL6B
Conjugation: Biotin
Alternative Names: MLC1SA
MYL6B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 002466
UniProt: P14649
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFL