DPYSL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2110048
Artikelname: DPYSL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2110048
Hersteller Artikelnummer: orb2110048
Alternativnummer: BYT-ORB2110048-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPYSL2
Konjugation: Biotin
Alternative Synonym: DRP2, N2A3, CRMP2, DRP-2, ULIP2, CRMP-2, DHPRP2, ULIP-2
DPYSL2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 001377
UniProt: Q16555
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKR