DPYSL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110048
Article Name: DPYSL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110048
Supplier Catalog Number: orb2110048
Alternative Catalog Number: BYT-ORB2110048-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPYSL2
Conjugation: Biotin
Alternative Names: DRP2, N2A3, CRMP2, DRP-2, ULIP2, CRMP-2, DHPRP2, ULIP-2
DPYSL2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 001377
UniProt: Q16555
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKR