PROSER3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2110210
Artikelname: PROSER3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2110210
Hersteller Artikelnummer: orb2110210
Alternativnummer: BYT-ORB2110210-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human PROSER3
Konjugation: Biotin
Alternative Synonym: C19orf55
PROSER3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 001034976
UniProt: Q2NL68
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PSTTEGQMWASPAPTLIDSGDSVVAKYINRFRQAQPTSREERQPAGPTPA