PROSER3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110210
Article Name: PROSER3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110210
Supplier Catalog Number: orb2110210
Alternative Catalog Number: BYT-ORB2110210-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human PROSER3
Conjugation: Biotin
Alternative Names: C19orf55
PROSER3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 001034976
UniProt: Q2NL68
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PSTTEGQMWASPAPTLIDSGDSVVAKYINRFRQAQPTSREERQPAGPTPA