Sorbs1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2110255
| Artikelname: |
Sorbs1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2110255 |
| Hersteller Artikelnummer: |
orb2110255 |
| Alternativnummer: |
BYT-ORB2110255-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Sorbs1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
C, CAP, Sh3d, Sh3d5, SH3P12, mKIAA1296, 2310065E01Rik, 9530001P15Rik |
| Sorbs1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
103kDa |
| NCBI: |
848139 |
| UniProt: |
D3Z5J3 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC |
