Sorbs1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2110255
| Article Name: |
Sorbs1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2110255 |
| Supplier Catalog Number: |
orb2110255 |
| Alternative Catalog Number: |
BYT-ORB2110255-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Sorbs1 |
| Conjugation: |
Biotin |
| Alternative Names: |
C, CAP, Sh3d, Sh3d5, SH3P12, mKIAA1296, 2310065E01Rik, 9530001P15Rik |
| Sorbs1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
103kDa |
| NCBI: |
848139 |
| UniProt: |
D3Z5J3 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC |
