CLPTM1L Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2112354
Artikelname: CLPTM1L Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2112354
Hersteller Artikelnummer: orb2112354
Alternativnummer: BYT-ORB2112354-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CLPTM1L
Konjugation: FITC
Alternative Synonym: CRR9
CLPTM1L Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 110409
UniProt: Q96KA5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD