CLPTM1L Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2112354
Article Name: CLPTM1L Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112354
Supplier Catalog Number: orb2112354
Alternative Catalog Number: BYT-ORB2112354-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CLPTM1L
Conjugation: FITC
Alternative Names: CRR9
CLPTM1L Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 110409
UniProt: Q96KA5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD