TNMD Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2112775
Artikelname: TNMD Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2112775
Hersteller Artikelnummer: orb2112775
Alternativnummer: BYT-ORB2112775-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNMD
Konjugation: Biotin
Alternative Synonym: TEM, CHM1L, BRICD4
TNMD Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 071427
UniProt: Q9H2S6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCI