TNMD Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2112775
Article Name: TNMD Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112775
Supplier Catalog Number: orb2112775
Alternative Catalog Number: BYT-ORB2112775-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNMD
Conjugation: Biotin
Alternative Names: TEM, CHM1L, BRICD4
TNMD Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 071427
UniProt: Q9H2S6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCI