NLGN4X Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2112970
Artikelname: NLGN4X Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2112970
Hersteller Artikelnummer: orb2112970
Alternativnummer: BYT-ORB2112970-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NLGN4X
Konjugation: Biotin
Alternative Synonym: HLNX, HNL4X, NLGN4, ASPGX2, AUTSX2
NLGN4X Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 92kDa
NCBI: 065793
UniProt: Q8NFZ3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN