NLGN4X Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2112970
Article Name: NLGN4X Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112970
Supplier Catalog Number: orb2112970
Alternative Catalog Number: BYT-ORB2112970-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NLGN4X
Conjugation: Biotin
Alternative Names: HLNX, HNL4X, NLGN4, ASPGX2, AUTSX2
NLGN4X Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 92kDa
NCBI: 065793
UniProt: Q8NFZ3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN